Neuregulin 3 anticorps (Middle Region)

N° du produit ABIN634810

Cet anticorps Lapin Polyclonal détecte spécifiquement Neuregulin 3 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Neuregulin 3 anticorps (Middle Region) (ABIN634810)

Antigène: Neuregulin 3 (NRG3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Neuregulin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Neuregulin 3 anticorps

Épitope: Middle Region

Specificité: NRG3 antibody was raised against the middle region of NRG3

Purification: Affinity purified

Immunogène: NRG3 antibody was raised using the middle region of NRG3 corresponding to a region with amino acids TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NRG3 Blocking Peptide, (ABIN5615063), is also available for use as a blocking control in assays to test for specificity of this NRG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Neuregulin 3

Antigène: Neuregulin 3 (NRG3)

Autre désignation: NRG3

Sujet: Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Signalisation RTK